SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035474 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035474
Domain Number 1 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 239-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 277-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 4 Region: 40-88
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-18
Family SCAN domain 0.00038
Further Details:      
 
Domain Number 5 Region: 378-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035474   Gene: ENSMMUG00000014082   Transcript: ENSMMUT00000042468
Sequence length 437
Comment pep:known chromosome:MMUL_1:3:47333451:47343392:1 gene:ENSMMUG00000014082 transcript:ENSMMUT00000042468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTKVLGMAPVLGPRPPQEQVGPLMVKVEEKEEKGKCLPSLEMFRQRFRQFGYHDTPGPR
EALSQLRVLCCEWLRPEIHTKEQILELLRELDEPGHQVSTPPNEQKPVWEKISSSGTAKE
SPSSVQPQPLETSHKYESWGPLYIQETGEEQEFTQDPRKTRDCRLSTQHEESADEQKGSE
ADGLKGDIISVIIANKPEARLERQCVKLENEKGAKPPLQESGSKKGRESVPTKPTPGERR
YICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDCK
CGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTGEKPYQCNECGKS
FSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGEKPYWCHHCGKTFCSK
SNLSKHQRVHTGEGEAL
Download sequence
Identical sequences A0A2K5N157 A0A2K5W1L2 A0A2K5YV11 A0A2K6BHK5 F7CE27
ENSMMUP00000035474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]