SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035545 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035545
Domain Number 1 Region: 3-57
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000288
Family AN1-like Zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035545   Gene: ENSMMUG00000030435   Transcript: ENSMMUT00000042537
Sequence length 185
Comment pep:known_by_projection chromosome:MMUL_1:3:39066970:39073553:-1 gene:ENSMMUG00000030435 transcript:ENSMMUT00000042537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFTYAAHKCPFAFQKDVQVPVCPLC
NTPIPVKKGQIPDVVVSDHIDRDCDSHPGKKKEKSFCSLRFLYTVAQKRAARRKRCCRWH
VPSVTATSVSSTDTLWTIAADTGVALPSKPGEKRLSCDGLEHAVACVEAACTLVGGGAPS
STVPH
Download sequence
Identical sequences F7ERW6 G7P254
ENSMMUP00000035545 9544.ENSMMUP00000035545 ENSMMUP00000035545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]