SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035577 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035577
Domain Number 1 Region: 375-565
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.96e-69
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000205
Further Details:      
 
Domain Number 2 Region: 29-123
Classification Level Classification E-value
Superfamily A heparin-binding domain 1.57e-44
Family A heparin-binding domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 124-188
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.62e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.00001
Further Details:      
 
Domain Number 4 Region: 286-344
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035577   Gene: ENSMMUG00000014384   Transcript: ENSMMUT00000042567
Sequence length 752
Comment pep:known chromosome:MMUL_1:3:20488994:20777537:1 gene:ENSMMUG00000014384 transcript:ENSMMUT00000042567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVMSQSLRKTTREPLTRD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVTLRYQETSFFA
SSMNMLPKKDPSIHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEGSGLTNIKTEEISEVKMDAEFRHD
SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEV
DAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences ENSMMUP00000035577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]