SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035591 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035591
Domain Number 1 Region: 146-255
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000232
Family DNA polymerase processivity factor 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035591   Gene: ENSMMUG00000000441   Transcript: ENSMMUT00000042580
Sequence length 271
Comment pep:known_by_projection chromosome:MMUL_1:9:119245101:119245942:1 gene:ENSMMUG00000000441 transcript:ENSMMUT00000042580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQQTQDENDQYSLVASLDNVRNLSTILKASDFRKCGTHFATKNGIKVTMENAKCVQ
ANAFIQAGIFQELKVQEESVAFRINLIVLLDCLSIFGSSPMPEQGYGDPLMLFLEEGGAA
AVCKINTQEPEDLDFNFYSTNITDKILQSEGLHEAFSELDMTSEVLQITMSPDKPCFRLS
TFGNVGSSHLDCPKDSDLMEAFHYHQTQVNRYKIYLLKPSTKALVLSCQVSIRTDNRGFL
SLQYMVRNEDGPIYFVEYDCSPDEEVLESES
Download sequence
Identical sequences 9544.ENSMMUP00000035591 ENSMMUP00000035591 ENSMMUP00000035591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]