SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035698 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035698
Domain Number 1 Region: 37-230
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.42e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000808
Further Details:      
 
Domain Number 2 Region: 226-358
Classification Level Classification E-value
Superfamily E set domains 1.59e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035698   Gene: ENSMMUG00000002990   Transcript: ENSMMUT00000042690
Sequence length 402
Comment pep:known chromosome:MMUL_1:9:102053299:102056269:1 gene:ENSMMUG00000002990 transcript:ENSMMUT00000042690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESCYNPGLDGIIEYDDFKLNSSIMEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGEGVLREGGVKAREAVEEKKGEARRGGSHL
Download sequence
Identical sequences ENSMMUP00000035698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]