SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035728 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035728
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 257-331
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000429
Further Details:      
 
Domain Number 3 Region: 11-86
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035728   Gene: ENSMMUG00000003825   Transcript: ENSMMUT00000042719
Sequence length 339
Comment pep:known chromosome:MMUL_1:3:824414:869673:-1 gene:ENSMMUG00000003825 transcript:ENSMMUT00000042719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKVSEGGLNVTLTIRLLMHGKVRGATIGTKGETVKKMREESGARINISEGNCPERIVT
ITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKI
KEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRP
KPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLH
SSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA
TEGSSERQITITGTPANISLAQYLINARLTSEVTGMGTL
Download sequence
Identical sequences ENSMMUP00000035728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]