SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035741 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035741
Domain Number 1 Region: 32-391,432-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.45e-45
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035741   Gene: ENSMMUG00000020603   Transcript: ENSMMUT00000042732
Sequence length 581
Comment pep:known_by_projection chromosome:MMUL_1:9:97973961:98005822:-1 gene:ENSMMUG00000020603 transcript:ENSMMUT00000042732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRGLCRAVAASPFPAWRGAHTEAGGGLKPEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFERRHVIGGAAVTEEIVPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPYSFT
PMLEEGAGSKVPRSLLLGTDMAENQKQIAQFSRKDAQVFPRYEEFMHRLALAIDPLLDAA
PVDMAAFQRGSLLQRIKSLSTLKPLLKAGRILGAQLPQYYEVLTAPITKVLDQWFESEPL
KATLATDAVIGAMTSPRTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATT
HGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKVVLSNTSPQITFLKLTPQEWLPEE
FLEKISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGHPLPHHQCSIHLNCEDTLLLHQAF
EDAMDGLPSHRPMIELCIPSALDPTLAPSGCHVVSLFTQYTPYTLAGGKAWDEQERDAYA
DRVFDCIEVYAPGFRDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHS
GYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHAAFRDLKSK
Download sequence
Identical sequences ENSMMUP00000035741 NP_001181250.1.72884 9544.ENSMMUP00000035741 ENSMMUP00000027123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]