SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035752 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035752
Domain Number 1 Region: 89-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 3.4e-60
Family Ngr ectodomain-like 0.00028
Further Details:      
 
Domain Number 2 Region: 759-896
Classification Level Classification E-value
Superfamily L domain-like 2.89e-34
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 3 Region: 1150-1338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-33
Family Laminin G-like module 0.0063
Further Details:      
 
Domain Number 4 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000722
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000782
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 6 Region: 1083-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 965-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1044-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000629
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 1334-1374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000222
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035752
Domain Number - Region: 1380-1411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000443
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035752   Gene: ENSMMUG00000010428   Transcript: ENSMMUT00000042743
Sequence length 1461
Comment pep:known_by_projection chromosome:MMUL_1:9:96579892:96762267:-1 gene:ENSMMUG00000010428 transcript:ENSMMUT00000042743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTPGWGSSAGPVRPELWLLLWAAAWSLGASACPALCTCTGTTVDCHGTGLQAIPKNIP
RNTERLELNGNNITRIHKNDFVGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQINCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPTCTLSSGSCPAMCTCSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLSNKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECNSDVICPHKCRCEASVVECSSLKLTKIPERIPQ
STAELRLNNNEISILEATGMFKKLTHLKKINLSNNKVSEIEDGAFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNQITTVSPGAFDTL
QSLSTLNLLANPFNCNCQLAWLGGWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STFKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLRSLRLLSLH
GNDISTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIARCAGPLDME
GKLLLTTPAKKFECQGPPTLAVQAKCDPCLSSPCQNQGICHNDPLEVYRCACPSGYKGRD
CEVSLDSCSSGPCENGGTCHAQEGKDAPFMCSCPTGFEGPTCGVNTDDCVDHACANGGVC
VDGVGNYTCQCPVQYEGRACEQLVDLCSPDLNPCQHEARCVGTPDGPRCECVPGYAGDNC
SENQDDCRDHRCQNGAQCMDEVNSYSCLCAEGYSGQLCEIPPHLPTPKSPCEGTECQNGA
NCVDQGNRPVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVRESGSR
GPWLRPEHQDASLHVPRQGWSRLTPTPGWGTPSCSSAETINDGQFHTVELVAFDQMVNLS
IDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQILNGTGFHGCIRNLYINN
ELQDFTKTQMKPGVVPGCEPCLKLYCLHGICQPNATPGPMCHCEAGWVGLHCDQPADGPC
HGHKCVHGQCVPLDALSYSCQCQDGYSGALCVSKSPSAGGTLSGTFTRSRGAMPSARPRA
PCHGWSAGARAQARAAARAFG
Download sequence
Identical sequences ENSMMUP00000035752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]