SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036003 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036003
Domain Number 1 Region: 38-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.42e-17
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 161-222
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.96e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 3 Region: 219-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.36e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 125-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000649
Family LIM domain 0.00087
Further Details:      
 
Domain Number 5 Region: 1-35
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000328
Family LIM domain 0.0028
Further Details:      
 
Domain Number 6 Region: 96-127
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000497
Family LIM domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036003
Domain Number - Region: 278-307
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.018
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036003   Gene: ENSMMUG00000004179   Transcript: ENSMMUT00000042991
Sequence length 411
Comment pep:known chromosome:MMUL_1:13:134098372:134142606:-1 gene:ENSMMUG00000004179 transcript:ENSMMUT00000042991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDALANAVCQRCQARFAPAERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEGRKYCE
HDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNASRHLCRP
CHNREKAKGLGKYICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKELTAEARELKGELY
CLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKKGLAYC
ETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVC
KRCYEKFPLELKKRLKKLSELTSRPSPRPRTSTLPEGPLARLSGPLPSPLPLSLLSPLGP
VHLRLPHLTLPFSFLIASSLPVPSSLPSPCLSSPWLWLPSVRRQELGSGSL
Download sequence
Identical sequences 9544.ENSMMUP00000036003 ENSMMUP00000036003 ENSMMUP00000036003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]