SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036008 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036008
Domain Number 1 Region: 145-174,227-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.32e-72
Family Eukaryotic proteases 0.0000000211
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 8.58e-26
Family GLA-domain 0.0000701
Further Details:      
 
Domain Number 3 Region: 93-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036008   Gene: ENSMMUG00000001038   Transcript: ENSMMUT00000042996
Sequence length 474
Comment pep:known chromosome:MMUL_1:17:93243959:93268576:1 gene:ENSMMUG00000001038 transcript:ENSMMUT00000042996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRPLHLVLLSAFLASLLLPGESLFIRREQANNVLARVRRSNSFLEEMKKGNLERECMEE
TCSYEEAREVFEDSDKTNEFWNKYKDGDQCETSPCQNEGKCRDGLGEYTCTCLEGFEGKN
CELFTRKLCSLDNGECDQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERR
KRSAAQATNSSGEAPDNIIWKPDDAADLDATENPFDLLDFNQTQPERGDNNLIRIVGGRE
CENGECPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRDMEQEEGGE
AVHEVEVIIKHNRFTKETYDFDIAVLRLKSPITFRMNVAPACLPERDWAESTLMTQKTGI
VSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYHAKQEDACQGDSG
GPHVTRFKDTYFVTGIVSWGEGCARKGKYWDLHQGHRLPQVDRQVHENQGLAQG
Download sequence
Identical sequences ENSMMUP00000036008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]