SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036009 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036009
Domain Number 1 Region: 146-427
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.28e-79
Family Eukaryotic proteases 0.000000011
Further Details:      
 
Domain Number 2 Region: 81-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000145
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036009   Gene: ENSMMUG00000001036   Transcript: ENSMMUT00000042997
Sequence length 441
Comment pep:known_by_projection chromosome:MMUL_1:17:93229086:93240551:1 gene:ENSMMUG00000001036 transcript:ENSMMUT00000042997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRALGLLCLLLGLQGCLAAGRLTQDTSHGALHTHRSPHIRHLTLSTLHTRDTSHSGSP
TPARGLSSAHRWKLFWISYSDGDQCASNPCQNGGSCKDQLQSYICFCLPSFEGRNCEKNK
DDQLICVNENGGCEQYCSDHAGAKRSCWCHEGYSLLADGVSCMPTVEYPCGKIPILEKRN
ASKPQGRIVGGRVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKSWRNLT
AVLGEHDLSEHEGDEQSRRVAQVIIPSTYVLGATNHDIALLRLQQPVVLTDHVVPLCLPE
RTFSERTLAFVRFSLVSGWGQLLDRGATALELMALNVPRLMTQDCLQQSQKAEASPNITE
YMFCAGYSDGSRDSCKGDSGGPHATRYRGTWYLTGIVSWGQGCAAVGHFGVYTRVSQYIE
WLQKLMHSEPRPGVLLRAPFP
Download sequence
Identical sequences ENSMMUP00000036009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]