SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036020 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036020
Domain Number 1 Region: 261-445
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.33e-48
Family DBL homology domain (DH-domain) 0.00000000774
Further Details:      
 
Domain Number 2 Region: 487-575
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-26
Family Pleckstrin-homology domain (PH domain) 0.0000944
Further Details:      
 
Domain Number 3 Region: 186-256
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-25
Family SH3-domain 0.0000378
Further Details:      
 
Domain Number 4 Region: 2-146
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.25e-22
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036020   Gene: ENSMMUG00000013138   Transcript: ENSMMUT00000043005
Sequence length 800
Comment pep:known_by_projection chromosome:MMUL_1:17:91113040:91282123:1 gene:ENSMMUG00000013138 transcript:ENSMMUT00000043005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPLQHLVTTILFSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPLSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSVSKHIVFSPQASFQMIKKCADMKEKQSRHSMAVFV
LTFVSRCCLRNEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHR
NAFEISGSMIERILVSCNNQQDLQEWVDHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVT
PSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRP
SAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTS
AKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAH
SYRMGSTSRKSCCSYISHQN
Download sequence
Identical sequences ENSMMUP00000017261 9544.ENSMMUP00000036020 ENSMMUP00000036020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]