SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036053 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036053
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.5e-47
Family C-type lysozyme 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036053   Gene: ENSMMUG00000017369   Transcript: ENSMMUT00000043039
Sequence length 148
Comment pep:novel chromosome:MMUL_1:9:30788164:30808180:-1 gene:ENSMMUG00000017369 transcript:ENSMMUT00000043039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTT
AQRVLDDGSIDYGIFQINSFTWCRHGKLQENNHCHVACSALITDDLTDAIICARKIVKET
RGMNYWQGWKKHCEGRDLSDWKKGCEVS
Download sequence
Identical sequences A0A2K5VIW7 F7HFG9
XP_002805651.1.72884 XP_005564939.1.63531 XP_005564960.1.63531 XP_005564961.1.63531 XP_008000860.1.81039 XP_008000861.1.81039 XP_015002209.1.72884 ENSMMUP00000036053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]