SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036071 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036071
Domain Number 1 Region: 259-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number 2 Region: 346-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 3 Region: 123-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 180-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 307-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 6 Region: 87-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Integrin beta EGF-like domains 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036071
Domain Number - Region: 220-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000114
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 35-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 7-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Integrin beta EGF-like domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036071   Gene: ENSMMUG00000002873   Transcript: ENSMMUT00000043057
Sequence length 389
Comment pep:known_by_projection chromosome:MMUL_1:17:81892343:82032695:1 gene:ENSMMUG00000002873 transcript:ENSMMUT00000043057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAMVSVTGKCKCDHGWYGDACQYPTHCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCD
NSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPW
ESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSD
DFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSPEESIRKCQGSSDLPCSGRGKCECGK
CTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCICERGWFGKLCQHPRKCN
MTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTG
NGICSCGNCECWDGWNGNACEIWLGSEYP
Download sequence
Identical sequences ENSMMUP00000036071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]