SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036072 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036072
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily Lysozyme-like 6.7e-48
Family C-type lysozyme 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036072   Gene: ENSMMUG00000013755   Transcript: ENSMMUT00000043058
Sequence length 148
Comment pep:novel chromosome:MMUL_1:9:29429118:29450851:1 gene:ENSMMUG00000013755 transcript:ENSMMUT00000043058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTT
AQRVLDDGSIDYGIFQINSFTWCRHGKLQENNHCHVACSALITDDLTDAIICARKIVKET
QGMNYWQGWKKHCEGRDLSDWKKGCEVS
Download sequence
Identical sequences A0A080YV22 A0A2K6DEA3
ENSMMUP00000036072 XP_001082288.1.72884 XP_008017782.1.81039 XP_011736636.1.29376 XP_011736637.1.29376 XP_011939987.1.92194 XP_015002183.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]