SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036174 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036174
Domain Number 1 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000242
Family LIM domain 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036174   Gene: ENSMMUG00000009156   Transcript: ENSMMUT00000043162
Sequence length 117
Comment pep:known chromosome:MMUL_1:13:108437573:108447415:1 gene:ENSMMUG00000009156 transcript:ENSMMUT00000043162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGRARPCVIPENEEIPPAALNSVPEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEERS
Download sequence
Identical sequences ENSMMUP00000036174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]