SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036179 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036179
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.52e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 231-294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.25e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 173-234
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.42e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 137-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000031
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 13-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000143
Family LIM domain 0.00091
Further Details:      
 
Domain Number 6 Region: 108-139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000195
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036179
Domain Number - Region: 290-319
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0138
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036179   Gene: ENSMMUG00000009156   Transcript: ENSMMUT00000043167
Sequence length 337
Comment pep:known chromosome:MMUL_1:13:108317963:108468433:1 gene:ENSMMUG00000009156 transcript:ENSMMUT00000043167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGVAAGMTHSNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEG
LFYEFEGRKYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIG
FVKNAGRHLCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKEL
TADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLG
HRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLK
NKFVEFDMKPVCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences A0A0D9RWT0 A0A2I3M1U3 A0A2K6B232 F7BUC0 F7GXN4 K7C1D3
NP_001180412.1.87134 NP_001180412.1.92137 XP_002757528.1.60252 XP_002799414.1.72884 XP_008006514.1.81039 XP_011722920.1.29376 ENSP00000437912 ENSCJAP00000046223 gi|301601607|ref|NP_001180412.1| ENSMMUP00000036179 ENSP00000437912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]