SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036214 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036214
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000101
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036214   Gene: ENSMMUG00000030695   Transcript: ENSMMUT00000043203
Sequence length 68
Comment pep:novel chromosome:MMUL_1:9:17398074:17399461:-1 gene:ENSMMUG00000030695 transcript:ENSMMUT00000043203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWQGNGHVCEDINECEINNGGCSVAPLVECVNTPGSSHCQPCPPGYQGDGRVCTLIDICS
VGNGGCHP
Download sequence
Identical sequences G7PEG0
ENSMMUP00000036214 9544.ENSMMUP00000036214 ENSMMUP00000036214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]