SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036235 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036235
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 460-587
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-27
Family Cadherin 0.0032
Further Details:      
 
Domain Number 3 Region: 125-235
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-24
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 576-681
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 345-464
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-19
Family Cadherin 0.0051
Further Details:      
 
Domain Number 6 Region: 13-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036235   Gene: ENSMMUG00000022272   Transcript: ENSMMUT00000043225
Sequence length 889
Comment pep:known chromosome:MMUL_1:17:36651409:36742100:1 gene:ENSMMUG00000022272 transcript:ENSMMUT00000043225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQSGLPPAERGGGGRSK
SGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKV
EIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFG
LDVKSRGDGTKFPELVIQKALDREQQTHHTLVLTALDGGEPPRSATIQINVKVIDSNDNS
PVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKT
GLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGA
LSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAVKILDENDNPPRFTKGLYVLQ
VHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSF
NFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRN
AGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVE
LVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILL
AAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAM
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG
NNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQRDNIAPRLRTQKEPA
Download sequence
Identical sequences ENSMMUP00000036235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]