SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036241 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036241
Domain Number 1 Region: 249-467
Classification Level Classification E-value
Superfamily PRTase-like 2.63e-69
Family Phosphoribosyltransferases (PRTases) 0.000000241
Further Details:      
 
Domain Number 2 Region: 2-256
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 6.35e-64
Family Class II glutamine amidotransferases 0.000000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036241   Gene: ENSMMUG00000030710   Transcript: ENSMMUT00000043232
Sequence length 468
Comment pep:novel scaffold:MMUL_1:1099214808571:72:1475:-1 gene:ENSMMUG00000030710 transcript:ENSMMUT00000043232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIVGTLAASPVNQLLYDALLLLQHRGQDAAGIVTMQGQKCFMHKARGMVRDVFRTRNM
RALPGNIGLGQVRYPTAGNAYSEEEAQPFYVNAPFGIVLVHNGNLTNAHALKDELFDIDR
RHINTESDTEVLINVLAHELELAARDLPLTPKEIFAAVRAVQKRIKGSYAVIALIAGQGL
LAFRDPYGIRPLCFGRASNGDFMVASESVALEGTGHQLERDVAPGEALFVDMTGKLHTEQ
CNDNPQLNPCMFEFVYLARPDSVMDGISVYQARLNMGETLAQRVISTMPPSEIDVVIPIP
ESSRPSAMQLAHRIGKPYREGFVKNRYVGRTFIMPGQGARKKSVRQKLNAIGLEFKNRNV
LLVDDSIVRGTTSKEIVQMAREAGARKVYLASAAPPVRFPNVYGIDMPTREELIAHGRSI
EEIRHYIGADALIYQDVDAMKRVVAALHPGLAGFEASCFDGSYVTGDV
Download sequence
Identical sequences 9544.ENSMMUP00000036241 ENSMMUP00000036241 ENSMMUP00000036241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]