SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036253 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036253
Domain Number 1 Region: 37-168
Classification Level Classification E-value
Superfamily Lysozyme-like 1.39e-18
Family G-type lysozyme 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036253   Gene: ENSMMUG00000018017   Transcript: ENSMMUT00000043244
Sequence length 178
Comment pep:known_by_projection chromosome:MMUL_1:13:99151488:99161500:-1 gene:ENSMMUG00000018017 transcript:ENSMMUT00000043244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSVVFWGLIALIGTSRGSYPFTHSMNPHLHPRLYHGCYGDIMTMKTSGATCDAKSVMN
CGIRGSEMFAEMDLRAIKPYQTLIKEVGQRYCVDPAVIAAIISRESHGGSVLQDGWDHRG
LKFGLMQLDKQAYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWNAAQHLRGFFLL
Download sequence
Identical sequences F7HCT7
ENSMMUP00000036253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]