SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036352 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036352
Domain Number 1 Region: 224-320
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.79e-43
Family GDI-like 0.00000669
Further Details:      
 
Domain Number 2 Region: 4-288
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-37
Family GDI-like N domain 0.0000000105
Further Details:      
 
Domain Number 3 Region: 322-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.12e-16
Family GDI-like N domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036352   Gene: ENSMMUG00000013182   Transcript: ENSMMUT00000043353
Sequence length 378
Comment pep:known chromosome:MMUL_1:9:6039744:6075747:-1 gene:ENSMMUG00000013182 transcript:ENSMMUT00000043353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLM
ANGLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMREVYKKFDLGQDVIDFTGH
ALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGG
TYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHP
IKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIR
PALELLEPIEQKFVSISDLLVPKDLGMESQIFISRTYDATTHFETTCDDIKNIYKRMTGS
EFDFEEMKRKKNDIYGED
Download sequence
Identical sequences ENSMMUP00000036352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]