SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036360 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036360
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-23
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036360   Gene: ENSMMUG00000030776   Transcript: ENSMMUT00000043361
Sequence length 84
Comment pep:known_by_projection scaffold:MMUL_1:1099214738367:5356:6987:1 gene:ENSMMUG00000030776 transcript:ENSMMUT00000043361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYNTAMAVCNSISNPVTKEMLFEFI
DRCTAASQGQKRKHHLDPDTELMP
Download sequence
Identical sequences Q7Z3R6
ENSMMUP00000036360 ENSMMUP00000036360 9544.ENSMMUP00000036360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]