SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036778 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036778
Domain Number 1 Region: 157-337
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.9e-36
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 429-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 358-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000973
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 395-438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036778
Domain Number - Region: 127-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.03
Family Laminin-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036778   Gene: ENSMMUG00000001421   Transcript: ENSMMUT00000043790
Sequence length 892
Comment pep:known chromosome:MMUL_1:14:91429442:91477119:1 gene:ENSMMUG00000001421 transcript:ENSMMUT00000043790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGFRRTLRNAVLTQKQDSLHIISIQPVAGTNQLDMLFAVEMHSNEFYKPAYLIQKLSNA
RRHLENIMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRC
TCNGGLCPGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFAGNSY
IKYRLSENSKEEDFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCGSGPGIL
GISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTESSIYFGALVQAD
NIRSLTDTRVTQVLSGFQGCLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCVLYPDAC
ERSPCQHGGSCTGLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICN
CKAGLTGVTCEEDINECEREECENGGSCVNVFGSFLCNCTPGYVGQYCGLRPVVVPNIQA
GHSYVGKEELIGIAVVLFVIFILVVLFIVFRKKVFRKNYSRNNITLVQDPATAALLNKSN
GIPFRNLRGSGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKIVDGLGGEHQEMTT
FHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDAGTENKAVDDPGEVTCF
AGSNKGSNSEVQSLSSFQSDSGDDNAYHWDTSDWMPGARLSDIEEVPNYENQDGGSAHQG
STRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPLPEDFPDQYEALPPSQPVSLAST
LSPDCRRRPQFHPSQYLPPHPFPNETDLVGPPASCEFSTFTVSMNQGTEPTGPADSVSLS
LHNSRGTSSSDVSANCGFDNSEVAMSDYESVGELSLASLHIPFVETQHQTQV
Download sequence
Identical sequences ENSMMUP00000036778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]