SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036782 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036782
Domain Number 1 Region: 146-561
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.18e-133
Family Myeloperoxidase-like 0.00000000876
Further Details:      
 
Domain Number 2 Region: 568-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 617-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000188
Family EGF-like domain of nidogen-1 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036782   Gene: ENSMMUG00000009662   Transcript: ENSMMUT00000043795
Sequence length 666
Comment pep:known_by_projection chromosome:MMUL_1:13:1370175:1451716:1 gene:ENSMMUG00000009662 transcript:ENSMMUT00000043795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWAVLAVTLIMACTEAFFPFISRGKELLWGKPEESRVAGVLEESKRLVDTAMYATMQR
NLKKREILSPHQLLSFSKLPEPTSGEIARAAEIMETSIQAMKRKVNLKIQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRLITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPSILHNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFRGGADCQVTCENQNPCFPIQIITLRDYVPRILGPEAFQQYVGPYEGY
DSAANPTVSNVFSTAAFRFGHATIHPLVRRLDAGFQEHPGLPGLWLHETFFSPWTLLHGG
GLDPLIRGLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNE
WREFCGLPRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLF
ACLIGKQMKALRDGDWFWWENSHVFTDAQRHELEKHSLSRVICDNTGLTRVPVDAFRVGK
FPEDFESCDSIPGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYE
LQGHEQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGG
DGRTCV
Download sequence
Identical sequences ENSMMUP00000036782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]