SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000036834

Domain assignment for ENSMMUP00000036834 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMMUP00000036834
Domain Number 1	Region: 134-200
Classification Level	Classification	E-value
Superfamily	FnI-like domain	0.00000000000000101
Family	VWC domain	0.0045
Further Details:

Domain Number 2	Region: 4-60
Classification Level	Classification	E-value
Superfamily	FnI-like domain	0.00000000858
Family	VWC domain	0.031
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMMUP00000036834 Gene: ENSMMUG00000020644 Transcript: ENSMMUT00000043847
Sequence length	314
Comment	pep:known_by_projection chromosome:MMUL_1:14:72865968:72888697:-1 gene:ENSMMUG00000020644 transcript:ENSMMUT00000043847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MYQHGEIFSAHELFPSRLPNQCVLCSCTEGQIYCGLMTCPEPGCPAPLPLPDSCCQACKD EASEQSAEEDSVQSLHGVRHPQDPCSSDAGRKRGPGTPAPTGLSAPLSFIPRHFRPKGAG STTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILCTCEDGRQDCQRVTCPT EYPCHHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDNLRRFAL EHEASDVVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTPE LKVTASPDKVTKTL
Download sequence
Identical sequences	ENSMMUP00000036834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]