SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036835 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036835
Domain Number 1 Region: 81-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000146
Family VWC domain 0.022
Further Details:      
 
Domain Number 2 Region: 4-69
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036835   Gene: ENSMMUG00000020644   Transcript: ENSMMUT00000043848
Sequence length 284
Comment pep:known_by_projection chromosome:MMUL_1:14:72865962:72888227:-1 gene:ENSMMUG00000020644 transcript:ENSMMUT00000043848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSESAHVSCYRLHCPPVHCPQPVTEP
QQCCPRCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVLCSCTEGQI
YCGLMTCPEPGCPAPLPLPDSCCQACKDEASEQSAEEDSVQSLHGVRHPQDPCSSDAGRK
RGPGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKEDKADPGHSEISSTRCPK
APGRVLVHTSVSPSPDNLRRFALEHEASDVVEIYLWKLVKGTSS
Download sequence
Identical sequences ENSMMUP00000036835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]