SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036973 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036973
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.67e-38
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 85-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.26e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Domain Number 3 Region: 768-801
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000314
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 802-831
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000927
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036973   Gene: ENSMMUG00000020953   Transcript: ENSMMUT00000043972
Sequence length 976
Comment pep:known_by_projection chromosome:MMUL_1:14:59657728:59754934:-1 gene:ENSMMUG00000020953 transcript:ENSMMUT00000043972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKNWNQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQARHLYITKELEHYPLERLGSVRRSVNLSRRESDIRPSKLLTWCQQQTEGYQHVNVTD
LTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGREMV
SAQEPDELSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPR
KRTPRVDGQIGENDMNKRRRKGFNNLDEPSNFSSRSVGSNQECGSSKEGGNQNKVKSMAN
QLLAKFEESTRNPSLMKQEKKSPSGFHFHPSHLRTVRPQESMRKSFPLNLGGSDTCYFCK
KRVYVMERLSAEGHFFHRECFRCSVCATTLRLAAYTFDCDEGKFYCKPHFIHCKTNSKQR
KRRAELKQQREEEATWQEQEAPLRDTPTESSCAVAAIGTLEGSAPGISTSFFRKALGWPL
RLPRDLCNWMQGLLQAVGLHIRDNAYNYCYMYELLSLGLPLLWAFSEVLAAMYRESEGSL
ESICNWVLRCFPVKLR
Download sequence
Identical sequences ENSMMUP00000036973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]