SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036989
Domain Number 1 Region: 1-213
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.44e-59
Family Proteasome subunits 0.0000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036989   Gene: ENSMMUG00000016446   Transcript: ENSMMUT00000043986
Sequence length 238
Comment pep:known_by_projection chromosome:MMUL_1:14:57396207:57412003:1 gene:ENSMMUG00000016446 transcript:ENSMMUT00000043986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLC
NFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIF
QTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDL
TTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH
Download sequence
Identical sequences F5GX11
XP_008004286.1.81039 XP_008004293.1.81039 XP_008969703.1.60992 XP_008969704.1.60992 XP_009005967.1.60252 XP_009244831.1.23681 XP_009458260.1.37143 XP_011854960.1.47321 XP_011937288.1.92194 XP_014202193.1.60992 XP_014312061.1.53796 XP_015289652.1.63531 XP_015425604.1.95426 XP_016775931.1.37143 XP_016775932.1.37143 ENSP00000441166 ENSP00000441166 ENSMMUP00000036989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]