SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037028 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037028
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily L domain-like 1.19e-33
Family Ngr ectodomain-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037028
Domain Number - Region: 301-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0023
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037028   Gene: ENSMMUG00000018859   Transcript: ENSMMUT00000026511
Sequence length 820
Comment pep:known chromosome:MMUL_1:10:81274562:81277024:-1 gene:ENSMMUG00000018859 transcript:ENSMMUT00000026511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLGLWAAALLCVCRPGAVSADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDL
RLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTE
GMLRGMSRLQFLFVQHNLIEVVTPTAFSECPSLISIDLSSNRLSRLDGATFASLASLMVC
ELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPREFAGYPLLVPRPYHSLNAITV
LQAKCRNGSLPARPVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIK
LHHVTFTSATLVVIIPHPYSKMYVLVQYNNSYFSDVMTLKNKKEIVTLDKLRAHTEYTFC
VTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLR
KRRMQEEKQKSVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASIPSMIGEK
LPAAKGLEAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKE
VDKVNQIINNCIDALKLDSASFLGGGSGSGDPELAFECQSLPAAAAASSATAPGALERPS
FLSPPYKESSHHPLQRQLSADAAVTRKTCSVSSSGSIKSAKVFSLDVPDHPAATGLAKGD
SKYIEKGSPLNSPLDRLPLVPAGSGGGSGGGGGIHHLEVKPAYHCSEHRHSFPALYYEEG
ADSLSQRVSFLKPLTRSKRDSAYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHH
REEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL
Download sequence
Identical sequences A0A2K5UKG6 A0A2K6ATZ4 F6QTS4
9544.ENSMMUP00000037028 ENSMMUP00000037028 ENSMMUP00000037028 NP_001180721.1.72884 XP_005567420.1.63531 XP_011710748.1.29376 XP_011710749.1.29376 XP_011710750.1.29376 XP_011710752.1.29376 XP_011710753.1.29376 XP_011710754.1.29376 XP_011710755.1.29376 XP_011710756.1.29376 XP_011710757.1.29376 XP_011710758.1.29376 XP_011710759.1.29376 XP_015005755.1.72884 XP_015005756.1.72884 XP_015005758.1.72884 XP_015005759.1.72884 XP_015005760.1.72884 XP_015312716.1.63531 XP_015312717.1.63531 XP_015312718.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]