SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037068 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037068
Domain Number 1 Region: 53-92
Classification Level Classification E-value
Superfamily GLA-domain 0.0000000000000336
Family GLA-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037068   Gene: ENSMMUG00000031033   Transcript: ENSMMUT00000044064
Sequence length 224
Comment pep:known_by_projection chromosome:MMUL_1:14:38962324:38983744:-1 gene:ENSMMUG00000031033 transcript:ENSMMUT00000044064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTFLVLLSQLPTATLGFPHCTRGPKASKHAGEEVFTSKEEANFFIRRRLPYNRFDLELF
TPGDVERECNEELCNYEEAREIFVDEDKTVMWLIMKSTSMIRCYGNREKIDVMGLLTGLI
AAGVFLVIFGLLGYYLCITKCNRLQHPHSSAVYERGRHTPSIIFRRHEEAALSPLPPSVE
DAGLPSYEQAVALTRKHSVSPPPPYPGYTKGFRVFKKSMSLPSH
Download sequence
Identical sequences 9544.ENSMMUP00000037068 ENSMMUP00000037068 ENSMMUP00000037068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]