SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037087 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037087
Domain Number 1 Region: 304-582
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.05e-45
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000449
Family LIM domain 0.00045
Further Details:      
 
Domain Number 3 Region: 149-243
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000197
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 96-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000242
Family LIM domain 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037087
Domain Number - Region: 11-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0613
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037087   Gene: ENSMMUG00000015001   Transcript: ENSMMUT00000044081
Sequence length 638
Comment pep:known_by_projection chromosome:MMUL_1:10:75108652:75161869:1 gene:ENSMMUG00000015001 transcript:ENSMMUT00000044081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLCAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSCFRCSECQDSLTNWYYEKDGKLYC
PKDYWGKFGEFCHGCSLLMTGPFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPV
SQRLDQLRLEAQLAPHMQNAGHPHTLSTLDTKENLEGTLRRRSLRRSNSISRSPGPSSPK
EPLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNM
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLVCPTALGLASRVLSFLASL
SQRRLTWLSKAGHLGLRKDYFQVMSVQDSFVLSCVPQGKSYDETVDIFSFGIVLCEQIHE
VAVTLCPFLTEALLDEGVYLRSYNQEVAEPRFLPPTPWPCSYSTCNLPPSRPAFSKLEDS
FEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP
Download sequence
Identical sequences ENSMMUP00000019665 ENSMMUP00000037087 9544.ENSMMUP00000037087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]