SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037249 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037249
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-37
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 93-279
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-35
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 3 Region: 297-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.46e-29
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 4 Region: 515-537,740-905
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-19
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 5 Region: 915-1056
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-18
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 522-580
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000244
Family Fibrinogen C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037249   Gene: ENSMMUG00000008054   Transcript: ENSMMUT00000044235
Sequence length 1057
Comment pep:known chromosome:MMUL_1:12:106157859:106287643:-1 gene:ENSMMUG00000008054 transcript:ENSMMUT00000044235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPQTGAGGWTPLVSNKNQWLQIDLGERVEVTAVATQGGYGSSDWVTSYILMFSDSGRNW
KQYRREDSISGFLGNANADSVVQHRLWPPLEARYLRFLPVAWNPDSRIGMRVEAYGCAHR
SEVIDFDGESSLLYRFIQNTRSPGTDIISLKFKTLQSDGILFHRDGRNGNCITLELVKGK
LILFINSGNATQPSPPGQGGLALGSLLDDGHWHTVRLECSGRGLNLTVDRHSRPIWAPAE
LCHADLDPEISFGGILAPGKPMVFPRKNFRGCLENINFNGEDVIGLAKQQGPQILVTGTV
AFACAHPQTVPATFLSAQSHLALPGSPGADAASVSFQFRTWNRAGLLLSWGTRPGSGGFF
LALQDGRLHIIIRKMLIYTGLVSTGVGLNDGQWHSVSVTSTWGHLSVMVDDDVASTVHTT
VPVGVHPGDAYHFGGCPAHGSGSDCSRSLGPLGGFQGCLRLISIDGQEVDLISVQQGAVG
NFSDLLIDTCGILDRCLPNYCEHEGTCSQTWTAFHCDCSSTGYTGATCHRSLYEPSCEAY
KHLGHASGFYNIDPDGSGPLKPFQAFCNMTGDVPWTVLQHNGSALTRVKGASLENPHRAV
FQYTASAEQLLASIDRARHCQQELELHCRRSRLQDPRDGTALSWWAGRANETHTYWGGSF
PGAHQCACGLERDCLDPQYGCNCDADRDEWTSDVGVLSHREHLPVTQIVITDADRPGSEA
AYKLGPLQCQGDGSFWNSASFHTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGI
TDFISLELRSPAEVAFSFDVGNGPCELTVQSEVYTHRHTWKYIHTYERNLGLISLTNSRK
PSSVPSNASEEEYYNKMNQTQLFSSGTAARQRGFLGCIRALQVNGRTLDLEGRAKVTPGV
EPGCPGHCSTYGHLCLHGGQCREGHQGFSCDCELSAYTGPFCSSEISAYFGTGSSVTYNF
QEYHSPSTNASSHAASFQGETTLTQETIAFSFRTVQAPSLLLYVDSFYKEYLSVILAKNG
SLQIRYKLDTHQDPDVVNLNFRNMADGKLYHVNISRE
Download sequence
Identical sequences ENSMMUP00000037249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]