SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037257 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037257
Domain Number 1 Region: 22-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-35
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 2 Region: 235-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-27
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 3 Region: 839-998
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-20
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 443-465,668-829
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.32e-19
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 5 Region: 450-508
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000272
Family Fibrinogen C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037257   Gene: ENSMMUG00000008054   Transcript: ENSMMUT00000044243
Sequence length 1003
Comment pep:known chromosome:MMUL_1:12:106157793:106245128:-1 gene:ENSMMUG00000008054 transcript:ENSMMUT00000044243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLGNANADSVVQHRLWPPLEARYLRFLPVAWNPDSRIGMRVEAYGCAHRSEVIDFDGESS
LLYRFIQNTRSPGTDIISLKFKTLQSDGILFHRDGRNGNCITLELVKGKLILFINSGNAT
QPSPPGQGGLALGSLLDDGHWHTVRLECSGRGLNLTVDRHSRPIWAPAELCHADLDPEIS
FGGILAPGKPMVFPRKNFRGCLENINFNGEDVIGLAKQQGPQILVTGTVAFACAHPQTVP
ATFLSAQSHLALPGSPGADAASVSFQFRTWNRAGLLLSWGTRPGSGGFFLALQDGRLHVG
PRASPGQAQSGARTGLVSTGVGLNDGQWHSVSVTSTWGHLSVMVDDDVASTVHTTVPVGV
HPGDAYHFGGFLIFLHSCLQGGFQGCLRLISIDGQEVDLISVQQGAVGNFSDLLIDTCGI
LDRCLPNYCEHEGTCSQTWTAFHCDCSSTGYTGATCHRSLYEPSCEAYKHLGHASGFYNI
DPDGSGPLKPFQAFCNMTGDVPWTVLQHNGSALTRVKGASLENPHRAVFQYTASAEQLLA
SIDRARHCQQELELHCRRSRLQDPRDGTALSWWAGRANETHTYWGGSFPGAHQCACGLER
DCLDPQYGCNCDADRDEWTSDVGVLSHREHLPVTQIVITDADRPGSEAAYKLGPLQCQGD
GSFWNSASFHTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGITDFISLELRSPA
EVAFSFDVGNGPCELTVQSPVPVREVYTHRHTYERNLGLISLPTPLLPSSLLPTRLSDNK
MNQTQLFSSGTAARQRGFLGCIRALQVNGRTLDLEGRAKVTPGVEPGCPGHCSTYGHLCL
HGGQCREGHQGFSCDCELSAYTGPFCSSEISAYFGTGSSVTYNFQEYHSPSTNASSHAAS
FQGETTLTQETIAFSFRTVQAPSLLLYVDSFYKEYLSVILAKNGSLQIRYKLDTHQDPDV
VNLNFRNMADGKLYHVNISREDGVVFVEVTARSWHKPHSRHHL
Download sequence
Identical sequences ENSMMUP00000037257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]