SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037313 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037313
Domain Number 1 Region: 341-540
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000000000000422
Family DNA-binding domain from NDT80 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037313
Domain Number - Region: 186-196
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037313   Gene: ENSMMUG00000006655   Transcript: ENSMMUT00000044299
Sequence length 1151
Comment pep:known_by_projection chromosome:MMUL_1:14:12295251:12332378:-1 gene:ENSMMUG00000006655 transcript:ENSMMUT00000044299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVDETEALLRFFEGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASSASYS
HGQPAMPGSSGVHHLSPPGGGPSPGRHGPLPPPSYGPPLNCNNNNGMGAAPKPFPGGAGP
PIKAEPKAPYAPGTLPDSPPDSGSEAYSPQQVNEPHLLRTITPETLCHVGVPSRLEHPPP
PPAHLPGPPPPPPPPPHYPVLQRDLYMKAEPPVPPYAAMGQGLVPTDLHHTQQSQMLHQL
LQQHGAELPTHPSKKRKHSESPPSTLNAQMLNGMIKQEPGTVTALPLHPTRAPSPPWPPQ
GPLSPGPGSLPLSIARVQTPPWHPPGAPSPGLLQDSDSLSGSYLDPNYQSIKWQPHQQNK
WATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKFVKTP
EGLKPLDCFYLKLHGLQLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLH
FSETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESD
SDVLWQRAQVPDTVFHHGRVGINTDRPDEALVVHGNVKVMGSLMHPSDLRAKEHVQEVDT
TEQLKRISRMRLVHYRYKPEFAASAGIEATAPETGVIAQEVKEILPEAVKDTGDMVFANG
KTIENFLVVNKERIFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGS
SGAFSHAGSQFSRAGSVPHKKRPPKVASKSSSVVPDQACISQRFLQGTIIALVVVMAFSV
VSMSTLYVLSLRTEEDLVDTDGSFAVSTSCLLALLRPQPPGGSEALCPWSSQSFGTTQLR
QSPITTGLPGIQPTLLLVTTSLTSSAPGSAIRTLDLCSSHPCPVVCCSSPTTNPTTGPSL
GPSFNPGHVLSPSPSPSTNRSGPSQMALLPVTNIRAKSWGLSVNGIGHSKHHKSLEPLAS
PAVPFPGGLGKAKNSPSLGFHGRARRGAPQSSVGPAQPTWGQGQSASLLAEPVPSLTSIQ
VLENSMPITSQYCAPGDACRPGNFTYHIPVSSGTPLHLSLTLQMNSSSPVSVMLCSLRLK
EEPCEEGSLPQSLHTHQDTQGTSHQWPITILSFREFTYHFRVALLGQANCSSEALVQPAT
DYYFHFYRLCN
Download sequence
Identical sequences ENSMMUP00000037313 9544.ENSMMUP00000037313 ENSMMUP00000008748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]