SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037486 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037486
Domain Number 1 Region: 43-391
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.12e-78
Family (Glycosyl)asparaginase 0.0000608
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037486   Gene: ENSMMUG00000006519   Transcript: ENSMMUT00000044469
Sequence length 420
Comment pep:known chromosome:MMUL_1:10:46665203:46914772:-1 gene:ENSMMUG00000006519 transcript:ENSMMUT00000044469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMEKGMSSGEGLPSRSSQVSAGKITAKELEAKQSYKEKRGGFVLVHAGAGYHSESKAKE
YKHVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTNAGMGSNLNLLGEIECDASIM
DGKSLNFGAVGALSGIKNPVSVANRLLCEGQKGKLSAGRIPPCFLVGEGAYRWAVDHGIP
SCPPNIMTTRFSLAAFKRNKRKLELAERVETDFIQLKKRRQSSEKENDSGTLDTVGAVVV
DHEGNVAAAVSSGGLALKHPGRVGQAALYGCGCWAENTGAHNPYSTAVSTSGCGEHLVRT
ILARECSHALQAEDAHQALLETMQNKFISSPFLASEDGVLGGVIVLRSCRCSAEPDSSQN
KQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAIEGGVCRLESPVN
Download sequence
Identical sequences A0A096NVJ6 A0A0D9RHA0 A0A2K5U2B8 A0A2K6C8N9 A0A2K6RU45 F7H6R0
XP_001083347.1.72884 XP_007958610.1.81039 XP_007958618.1.81039 XP_007958622.1.81039 XP_010353564.1.97406 XP_011739418.1.29376 9544.ENSMMUP00000037486 ENSMMUP00000008585 ENSMMUP00000008585 ENSMMUP00000037486 ENSPANP00000017071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]