SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037595 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037595
Domain Number 1 Region: 1036-1255
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-85
Family Fibrinogen C-terminal domain-like 0.000000856
Further Details:      
 
Domain Number 2 Region: 687-847
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-24
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 3 Region: 865-1033
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.6e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 506-675
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-19
Family Fibronectin type III 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037595
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000149
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037595   Gene: ENSMMUG00000015723   Transcript: ENSMMUT00000044571
Sequence length 1268
Comment pep:known chromosome:MMUL_1:1:204922679:205006500:-1 gene:ENSMMUG00000015723 transcript:ENSMMUT00000044571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMLKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQDVSAEDETVAEYTGQTSDHESQVTFTHRINL
PKKACPCASSAQMLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCICEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPKGIGPTTRTTLTDLVPGT
EYGVGISAIMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGIDPPKDI
TISNVTKDSVMVSWSPPVASFDYYRVSYRPTQVGRLDSSVVPNTVTEFTITRLYPATEYE
ISLNSVRGREESERICTLVHTAMDNPVDLTATNITPTEALLQWKAPVGEVENYVIVLTHF
AVAGETILVDGVSEEFRLVDLLPSTHYTATMYATNGPLTSGTISTNFSTLLDPPANLTAS
EVTRQSALISWQPPRAEIENYVLTYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQ
AAQDTAWSSITSTAFTTGGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDM
TTDGGGWIVFQRRQNGQTDFFRKWADYRVGFGNLEDEFWLGLDNIHRITSQGRYELRVDM
RDGQEAAFASYDRFSVEDNRNLYKLRIGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNC
AMSYKGAWWYKNCHRTNLNGKYGESRHSQGINWYHWKGHEFSIPFVEMKMRPYSHRLMAG
RKRQSLQF
Download sequence
Identical sequences ENSMMUP00000037595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]