SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000037648

Domain assignment for ENSMMUP00000037648 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMMUP00000037648
Domain Number 1	Region: 102-199
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	4.07e-19
Family	PDZ domain	0.00011
Further Details:

Domain Number 2	Region: 190-289
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	5.78e-16
Family	PDZ domain	0.00012
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMMUP00000037648 Gene: ENSMMUG00000018165 Transcript: ENSMMUT00000044624
Sequence length	292
Comment	pep:known chromosome:MMUL_1:10:34565460:34584165:-1 gene:ENSMMUG00000018165 transcript:ENSMMUT00000044624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSSLYPSLEDLKVDQAIQAQARASPKMPALPVQAAAISPPPVLYPNLAELENYMGLSLSS QEVQQSLLQIPEGDSTAVSGPAPGQMVAPVSGYSLGVRRAEIKPGVREIHLCKDERGKTG LRLRTVDQGLFVQLVQANTPASLVGLRFGDQILQIDGRDCAGWSSRKANQVVKKASPEKI VMVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNV IGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLSPVLLHHTMDHSIPDA
Download sequence
Identical sequences	A0A2K5UX67 F7CR07 ENSMMUP00000023889 9544.ENSMMUP00000023889 XP_001112943.1.72884 XP_005568612.1.63531 ENSMMUP00000023889 ENSMMUP00000037648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]