SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037684 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037684
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-29
Family C-type lectin domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 502-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000122
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 199-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 4 Region: 440-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 254-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000584
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 378-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000126
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 315-382
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 579-644
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 634-699
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000175
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037684   Gene: ENSMMUG00000013044   Transcript: ENSMMUT00000044663
Sequence length 767
Comment pep:known_by_projection chromosome:MMUL_1:1:199296157:199325454:-1 gene:ENSMMUG00000013044 transcript:ENSMMUT00000044663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCQKAILYQRFRRVVFGIARLLCFSALISELTNQKEVAAWTYHYSTKAYSWNTSRKYCQ
NRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADNE
PNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNY
TCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPSK
LECLASGIWTHKPPQCLAVQCQHLEAPSEGTMDCIHPLAAFAYGSNCKFECQLGYRVRGL
DTLRCIGSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLR
GADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDLL
LVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDEG
FSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSCN
KGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTFG
FNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWGN
FSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTT
GLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSS
Download sequence
Identical sequences ENSMMUP00000037684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]