SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037686 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037686
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-29
Family C-type lectin domain 0.000000534
Further Details:      
 
Domain Number 2 Region: 262-326
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.59e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 503-568
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000118
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 441-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 379-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000121
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 7 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 580-645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000834
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 635-700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 10 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000175
Family EGF-type module 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037686   Gene: ENSMMUG00000013044   Transcript: ENSMMUT00000044665
Sequence length 768
Comment pep:known_by_projection chromosome:MMUL_1:1:199294857:199336549:-1 gene:ENSMMUG00000013044 transcript:ENSMMUT00000044665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCQKAILYQRFRRVVFGIARLLCFSALISELTNQKEVAAWTYHYSTKAYSWNTSRKYC
QNRYTDLVAIQNKKEIDYLNEVLPYYSTYYWIGIRKSNKTWTWVGTKKALTKEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGN
YTCSCYPGFYGPECEYVTECGELELPQHVLMNCSHPLGNFSFNSQCSFHCADGYQVNGPS
KLECLASGIWTHKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCGFSCEEGFVLVG
PEVVQCTASGVWTAPAPVCKAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFML
RGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEAQVNCSHPFGAFRYQSVCSFTCNEDL
LLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCHFICDE
GFSLSGPERLDCTRSGRWTDSPPTCEAIKCPELFAPEQGSLDCSDTHGEFNVGSTCHFSC
NKGFKLEGPNNVKCTTSGRWSATPPACKGIASLPSPGVQCPALTTPGQGTMHCRHHPGTF
GFNTTCYFGCNAGFTLTGDSILSCRPSGQWTAVTPTCRAVKCPELHVNKPIVMNCSNLWG
NFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVAST
TGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSS
Download sequence
Identical sequences ENSMMUP00000037686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]