SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037704 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037704
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.02e-62
Family T-box 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037704   Gene: ENSMMUG00000005283   Transcript: ENSMMUT00000044687
Sequence length 317
Comment pep:known chromosome:MMUL_1:1:197950988:198037323:1 gene:ENSMMUG00000005283 transcript:ENSMMUT00000044687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDS
PNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRMVTNCSFPE
TQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEALSESQHVTCSHLNLIES
SSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTISNSAGGPTGPGP
EVHASAPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVSTWTAVASHPFAG
WGGPGAGGHHSPSSLDG
Download sequence
Identical sequences ENSMMUP00000037704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]