SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037729 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037729
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily HMG-box 0.0000000196
Family HMG-box 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037729
Domain Number - Region: 167-254
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00117
Family Calponin-homology domain, CH-domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037729   Gene: ENSMMUG00000023463   Transcript: ENSMMUT00000044713
Sequence length 434
Comment pep:known chromosome:MMUL_1:1:196707849:196741305:1 gene:ENSMMUG00000023463 transcript:ENSMMUT00000044713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNRKASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREEEKEKYAEMARE
WRAAQGKDSGPSEKQKPVFTPLRKPGMLVPKQNVSPPDMSTLSLKGDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFINPGEIPRGFRFHCQAASDSSHK
IPISNFERGHNQATVLQNLYRFIHPNPGNWPPIYCKSDDRTRVNWCLKHMAKASEIRQDL
QLLTVEDLVVGIYQQKFLKEPSKTWIRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTEAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVGSSGFSHFN
SANQEQRSNTPIGDYPSRAKISGQNSSVRGRGITRLLESISNSSSNIHKFSNCDTSLSSY
MSQKDGYKSFSSLS
Download sequence
Identical sequences F7B842 G7NU39 Q4R786
NP_001247890.1.72884 XP_005539921.2.63531 ENSMMUP00000030892 ENSMMUP00000037729 9544.ENSMMUP00000037729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]