SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037737 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037737
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.65e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037737   Gene: ENSMMUG00000015068   Transcript: ENSMMUT00000044718
Sequence length 286
Comment pep:novel chromosome:MMUL_1:1:196439755:196446503:1 gene:ENSMMUG00000015068 transcript:ENSMMUT00000044718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDKKKIAVIGAGVSGLGAIKSCFEEGLEPVCSEKNNDIGGLWRYKETPESGRPGIYKSM
TCNTSKEMTTFSDYPFPDPYPNYLHNSKMMEYLRMYNRHFHLIKHIQFLSKVCRVRKHPD
FSSCGQWDVVVETDGKQTCVFDGIMICSGYYKNITLELETKSSSGKPRSRSRHSGETYKH
HDNFVGKTAVVVGIGNSGADVAGEISYIAEQVFLSTRRGAWIWNWVWDNGNPDITVFTCY
NTIMEKIFPTFMINKWVENKLNARFNHDNYGLQPQHSWIESIQVIS
Download sequence
Identical sequences 9544.ENSMMUP00000037737 ENSMMUP00000037737 ENSMMUP00000037737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]