SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037739 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037739
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.73e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.02
Further Details:      
 
Domain Number 2 Region: 249-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000777
Family FAD/NAD-linked reductases, N-terminal and central domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037739   Gene: ENSMMUG00000031251   Transcript: ENSMMUT00000044720
Sequence length 460
Comment pep:novel chromosome:MMUL_1:1:196382303:196393279:1 gene:ENSMMUG00000031251 transcript:ENSMMUT00000044720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASIYKSVTSNTSKEMSAYSDYPFPAHLPNYLHNSKLMEYFKMYVKHFHLLKHIWLMSKV
CSVKKCSNFSCTRQRDVVVETRGKQKSYVFHGIVVCSGLHSHSVLPLLILFFPTGIERFK
GQYIHNWQYKRPEKFGDEIIVIGLGNSGTDLAIELSHVAAQVFLSTRQGVWIWSRGMPMD
TALVTHFKSVLNKFYPAFLINRWTENKLNDKYKHAHCMINSNMVFLSHQMTISDDLPNHI
ICGRVVMKQNVTEFTETTTIFEDDSEKEIDAIIFATGYTLSFPFLKDDSSILDNQCSMFK
YVFPPRLEKPTLAFIGILRTVGATISTSEVQIHPSSWALRALRGLNKLLSVSDMMADIRK
KRKKMLEKVLLKNPHEAHRVYYVDYIDETASEIGAKPNLLSLFLWDPKLAMEVFFGPCTP
YQYCLQGPGKWAGTQEAILIQREQIIKPPMTHILTPDQPS
Download sequence
Identical sequences ENSMMUP00000037739 ENSMMUP00000037739 9544.ENSMMUP00000037739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]