SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037768 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037768
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.00000033
Family Acetyl-CoA synthetase-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037768   Gene: ENSMMUG00000017932   Transcript: ENSMMUT00000044749
Sequence length 212
Comment pep:known chromosome:MMUL_1:10:29631677:29682758:-1 gene:ENSMMUG00000017932 transcript:ENSMMUT00000044749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPEERGRSGSGSRGQEEAGAGGRAQSWSPPPEVSRSAHVPSLQRYRELHRRSVEEPRE
FWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGASTNICYNVLDRNVHEKKLGDK
VAFYWCSSSPGQGSCAQSMGTTNALRQPTLRSSLDTMLQEMAAGGTRMAITGSLAGLMTC
SMYLLEKRLAPLPHQTTSRMHLACLKPAQGKS
Download sequence
Identical sequences ENSMMUP00000037768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]