SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037853 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037853
Domain Number 1 Region: 117-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.004
Further Details:      
 
Domain Number 2 Region: 248-342
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000186
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 58-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000728
Family Cadherin 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037853
Domain Number - Region: 351-449
Classification Level Classification E-value
Superfamily Cadherin-like 0.0002
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037853   Gene: ENSMMUG00000004024   Transcript: ENSMMUT00000044832
Sequence length 837
Comment pep:known_by_projection chromosome:MMUL_1:14:426717:434156:-1 gene:ENSMMUG00000004024 transcript:ENSMMUT00000044832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWALLWPPLLLTGLLGRPPGTVAQVQYCSVNKSFFEVEENTNVTEPLVDIHVPEGQEV
TLGPLSTPFAFRIQGNQLFLNVSPDYEENSLLEAQLLCQSGGTPVTQLRVFVSVLDVNDN
APEFPFTTKEIRVEEDTKVNSTVIPETELQAKDKDKDDILFYTLQEATAGASDYFSLVGV
NHPALRLDRPLDFYERPNMAFRLLVRDTPEENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHTLPSPLVLHPGPIYAEDGDRGINQAIIYSIFSGNVNGTF
VIHRDSGNLTMARSVPRAMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYR
GTVALGAGAGVVVKDAAAPSQPLRVQARDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLTQAGAFYAEVEAKNTVTSGTATTVIEIQVSEQEPPSTETGGTTGPWTSTTSEAPRPPV
PSQGPSTTSSGGGTGPHPPSGTTLRPPTSSTPGRPPGVGTSTSHQPATPGGGTAQTPKPG
TSQPMPPGVGTSTSHQPATPGGGTAQTPEPGTSLPMPPSRNTPSSGQKPDLGSNESHDSH
SCRLTLQAPAPPGLTGTHRPLQPGSAEPEIWETAQAWVISKSMPGGGPSEDKRFSVVDMA
ALGGVLGALLLLALLGLTVLVHKHYGSRLKCCSGKAPEPQPSGYDNQAFLPDDEANWAPA
PSPTSDAKPAEAPPTPAEPAPPGPAPPGSAPEAPAAAVAGGSPAAVRSILTKERRPEGGY
KAVWFGEDIGAEADVVVLNTPTLDVDGASDSGSGDEGEGAGPGRGSHDEPGGDDSYI
Download sequence
Identical sequences ENSMMUP00000037853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]