SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037857 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037857
Domain Number 1 Region: 117-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000214
Family Cadherin 0.004
Further Details:      
 
Domain Number 2 Region: 248-342
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000871
Family Cadherin 0.0038
Further Details:      
 
Domain Number 3 Region: 57-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000357
Family Cadherin 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037857
Domain Number - Region: 351-414
Classification Level Classification E-value
Superfamily Cadherin-like 0.000871
Family Cadherin 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037857   Gene: ENSMMUG00000004024   Transcript: ENSMMUT00000044836
Sequence length 519
Comment pep:known_by_projection chromosome:MMUL_1:14:425946:434425:-1 gene:ENSMMUG00000004024 transcript:ENSMMUT00000044836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSWALLWPPLLLTGLLGRPPGTVAQVQYCSVNKSFFEVEENTNVTEPLVDIHVPEGQEV
TLGPLSTPFAFRIQGNQLFLNVSPDYEENSLLEAQLLCQSGGTPVTQLRVFVSVLDVNDN
APEFPFTTKEIRVEEDTKVNSTVIPETELQAKDKDKDDILFYTLQEATAGASDYFSLVGV
NHPALRLDRPLDFYERPNMAFRLLVRDTPEENVEPSHTATATLVLNVVPADLRPPWFLPC
TFSDGYVCIQAQYHGAVPTGHTLPSPLVLHPGPIYAEDGDRGINQAIIYSIFSGNVNGTF
VIHRDSGNLTMARSVPRAMTFLLLVKGQQADLARYSVTQVTVEAVAAAGSPPRFPQSLYR
GTVALGAGAGVVVKDAAAPSQPLRVQARDPEFSDLNSAITYRITNHSHFRMEGEVVLTTT
TLTQAGAFYAEVKVCTGDLRHPLNSDLPLPTRHRDCLGRLKSQRKSPRRCAWKPVVSNIC
RAGGPSPLLKSTWLGWGAALNTHPEAWTEARGGRCARVA
Download sequence
Identical sequences ENSMMUP00000037857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]