SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037902 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037902
Domain Number 1 Region: 233-477
Classification Level Classification E-value
Superfamily Caspase-like 8.07e-59
Family Caspase catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 90-187
Classification Level Classification E-value
Superfamily DEATH domain 7.65e-22
Family DEATH effector domain, DED 0.0085
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000436
Family DEATH effector domain, DED 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037902   Gene: ENSMMUG00000012310   Transcript: ENSMMUT00000044879
Sequence length 480
Comment pep:known_by_projection chromosome:MMUL_1:12:64866758:64914536:1 gene:ENSMMUG00000012310 transcript:ENSMMUT00000044879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVIHQVEEALDTDEKEMLLFLCRDVAVDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSAQGAGA
GYKNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGTQQEPVKTSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLQDTFTSLGYEVQKFLHLSVNGISQILGQFACMP
EHQDYDSFVCVLVSRGGSQSLYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKVFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQQRGLSTVHREADFFWSLCTADVSLLERSCSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGHMYDWNSRVPAKEKYYVWLQHTLRKKLILSYT
Download sequence
Identical sequences A0A2K5W001 H9FN52
ENSMMUP00000016150 XP_005573957.1.63531 XP_005573958.1.63531 XP_005573959.1.63531 XP_014966197.1.72884 XP_014966198.1.72884 XP_014966199.1.72884 ENSMMUP00000016147 ENSMMUP00000037902 9544.ENSMMUP00000037902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]