SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037916 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037916
Domain Number 1 Region: 146-462
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.43e-127
Family Transglutaminase core 0.00000000000946
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.78e-43
Family Transglutaminase N-terminal domain 0.000000238
Further Details:      
 
Domain Number 3 Region: 470-540
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-19
Family Transglutaminase, two C-terminal domains 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037916   Gene: ENSMMUG00000018925   Transcript: ENSMMUT00000044893
Sequence length 548
Comment pep:known chromosome:MMUL_1:10:26292812:26321507:1 gene:ENSMMUG00000018925 transcript:ENSMMUT00000044893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDLVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFS
VVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLE
ASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERREYVLTQQGFIYQGSAKFIKSIPW
NFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIQQDDGSVSKSINRSL
TVGLKISTKSVGRDEREDITHTYKYPEGSSEEREAFTRANHLNKLAEKEETGMAMRIRVG
QSMNMGSDFDVFAHITNNTAEEYVCRLLLCARTVSYNGILGPECGTKHLLNLNLEPFSGK
GLCSWSIC
Download sequence
Identical sequences ENSMMUP00000037916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]