SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038002 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038002
Domain Number 1 Region: 83-147
Classification Level Classification E-value
Superfamily BPTI-like 1.35e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 2 Region: 41-90
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000262
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 3 Region: 149-194
Classification Level Classification E-value
Superfamily Elafin-like 0.000000017
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 4 Region: 194-239
Classification Level Classification E-value
Superfamily Elafin-like 0.000000628
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038002   Gene: ENSMMUG00000003805   Transcript: ENSMMUT00000044988
Sequence length 241
Comment pep:novel chromosome:MMUL_1:10:18873750:18892468:1 gene:ENSMMUG00000003805 transcript:ENSMMUT00000044988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTVRTEGGHLPLYSSTFSWRNVAFLLLLSLALEWTSALLHKKNKQKPGLCPKERLACTA
ELPNSCNTDFDCQEYLKCCLFACQKKCMDPFQEPCTLPVRQGNCNHDAQRWYFDFKNYRC
TPFTYRGCKGNANNFLSENDCRTACMLVVKDGQCPLFPVTGRKECPPSCHSDIDCPQTDK
CCESRCGFVCARAWTVKQGFCPRKPLLCAQIDKPRCLQDDECPLVEKCCSLCGLKCTDPK
H
Download sequence
Identical sequences A0A2K5USC1 A0A2K6DZJ8
ENSMMUP00000038002 XP_001107439.1.72884 XP_011765168.1.29376 XP_011765169.1.29376 XP_015004421.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]